Lineage for d1ocxc_ (1ocx C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 303048Fold b.81: Single-stranded left-handed beta-helix [51160] (2 superfamilies)
    superhelix with each turn made by 3 strands with short links
  4. 303049Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (5 families) (S)
    duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 303064Family b.81.1.3: Galactoside acetyltransferase-like [51168] (3 proteins)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 303079Protein Maltose O-acetyltransferase [89400] (1 species)
  7. 303080Species Escherichia coli [TaxId:562] [89401] (1 PDB entry)
  8. 303083Domain d1ocxc_: 1ocx C: [86816]
    complexed with pbm

Details for d1ocxc_

PDB Entry: 1ocx (more details), 2.15 Å

PDB Description: e. coli maltose-o-acetyltransferase

SCOP Domain Sequences for d1ocxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocxc_ b.81.1.3 (C:) Maltose O-acetyltransferase {Escherichia coli}
stekekmiagelyrsadetlsrdrlrarqlihrynhslaeehtlrqqiladlfgqvteay
ieptfrcdygyniflgnnffanfdcvmldvcpirigdncmlapgvhiytathpidpvarn
sgaelgkpvtignnvwiggravinpgvtigdnvvvasgavvtkdvpdnvvvggnpariik
kl

SCOP Domain Coordinates for d1ocxc_:

Click to download the PDB-style file with coordinates for d1ocxc_.
(The format of our PDB-style files is described here.)

Timeline for d1ocxc_: