Class b: All beta proteins [48724] (126 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (2 superfamilies) superhelix with each turn made by 3 strands with short links |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (5 families) duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.3: Galactoside acetyltransferase-like [51168] (3 proteins) this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain |
Protein Maltose O-acetyltransferase [89400] (1 species) |
Species Escherichia coli [TaxId:562] [89401] (1 PDB entry) |
Domain d1ocxc_: 1ocx C: [86816] complexed with pbm |
PDB Entry: 1ocx (more details), 2.15 Å
SCOP Domain Sequences for d1ocxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocxc_ b.81.1.3 (C:) Maltose O-acetyltransferase {Escherichia coli} stekekmiagelyrsadetlsrdrlrarqlihrynhslaeehtlrqqiladlfgqvteay ieptfrcdygyniflgnnffanfdcvmldvcpirigdncmlapgvhiytathpidpvarn sgaelgkpvtignnvwiggravinpgvtigdnvvvasgavvtkdvpdnvvvggnpariik kl
Timeline for d1ocxc_: