Lineage for d1ob1f1 (1ob1 F:1-45)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031775Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 3031776Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species)
  7. 3031780Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [57242] (4 PDB entries)
  8. 3031784Domain d1ob1f1: 1ob1 F:1-45 [86758]
    Other proteins in same PDB: d1ob1a1, d1ob1a2, d1ob1b1, d1ob1b2, d1ob1c3, d1ob1d1, d1ob1d2, d1ob1e1, d1ob1e2, d1ob1f3
    complexed with cac

Details for d1ob1f1

PDB Entry: 1ob1 (more details), 2.9 Å

PDB Description: crystal structure of a fab complex whith plasmodium falciparum msp1-19
PDB Compounds: (F:) major merozoite surface protein

SCOPe Domain Sequences for d1ob1f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob1f1 g.3.11.4 (F:1-45) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenp

SCOPe Domain Coordinates for d1ob1f1:

Click to download the PDB-style file with coordinates for d1ob1f1.
(The format of our PDB-style files is described here.)

Timeline for d1ob1f1: