Lineage for d1oahb_ (1oah B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544896Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 544897Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 544980Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 544981Protein Cytochrome c nitrite reductase [48718] (4 species)
  7. 544982Species Desulfovibrio desulfuricans [TaxId:876] [89173] (1 PDB entry)
  8. 544984Domain d1oahb_: 1oah B: [86737]
    complexed with ca, cl, hem, zn

Details for d1oahb_

PDB Entry: 1oah (more details), 2.3 Å

PDB Description: cytochrome c nitrite reductase from desulfovibrio desulfuricans atcc 27774: the relevance of the two calcium sites in the structure of the catalytic subunit (nrfa).

SCOP Domain Sequences for d1oahb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oahb_ a.138.1.3 (B:) Cytochrome c nitrite reductase {Desulfovibrio desulfuricans}
tgiaetetkmsafkgqfpqqyasymknnedrimtdykgsvpyhkndnvnplpkgfkhaqp
ylknlwlgypfmyeynetrghtyaiddflnidrinrfaadgkgnlpatcwncktpkmmew
vsqygdkfwsmdvnefrakdkinahdetigcanchdpatmelrlyseplkdwlkrsgkdw
qkmsrnekrtlvcaqchveyyfthkdngpaakpvfpwdngfnpedmyqyykghgakgpdg
kpgpfvdwvhaaskvpmikmqhpeyetfqdgphgaagvscadchmqyvredgkkisshwm
tspmkdpemracrqchadktgeylrqrvlytqqktfdqllkaqemsvkaheavrlanaye
ghraanyealmaearemvrkgqlfwdyvsaensvgfhnpakaldtlmtsmecsqkavdla
teatdfgiapalagdikklvppiltlsrklqqdpeflkqnpwtrllpalpkaeqvwegqd
ra

SCOP Domain Coordinates for d1oahb_:

Click to download the PDB-style file with coordinates for d1oahb_.
(The format of our PDB-style files is described here.)

Timeline for d1oahb_: