Class a: All alpha proteins [46456] (179 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (6 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein Cytochrome c nitrite reductase [48718] (4 species) |
Species Desulfovibrio desulfuricans [TaxId:876] [89173] (1 PDB entry) |
Domain d1oahb_: 1oah B: [86737] complexed with ca, cl, hem, zn |
PDB Entry: 1oah (more details), 2.3 Å
SCOP Domain Sequences for d1oahb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oahb_ a.138.1.3 (B:) Cytochrome c nitrite reductase {Desulfovibrio desulfuricans} tgiaetetkmsafkgqfpqqyasymknnedrimtdykgsvpyhkndnvnplpkgfkhaqp ylknlwlgypfmyeynetrghtyaiddflnidrinrfaadgkgnlpatcwncktpkmmew vsqygdkfwsmdvnefrakdkinahdetigcanchdpatmelrlyseplkdwlkrsgkdw qkmsrnekrtlvcaqchveyyfthkdngpaakpvfpwdngfnpedmyqyykghgakgpdg kpgpfvdwvhaaskvpmikmqhpeyetfqdgphgaagvscadchmqyvredgkkisshwm tspmkdpemracrqchadktgeylrqrvlytqqktfdqllkaqemsvkaheavrlanaye ghraanyealmaearemvrkgqlfwdyvsaensvgfhnpakaldtlmtsmecsqkavdla teatdfgiapalagdikklvppiltlsrklqqdpeflkqnpwtrllpalpkaeqvwegqd ra
Timeline for d1oahb_: