Lineage for d1o3qa2 (1o3q A:8-137)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 303155Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 303386Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 303392Family b.82.3.2: cAMP-binding domain [51210] (3 proteins)
  6. 303393Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)
  7. 303394Species Escherichia coli [TaxId:562] [51212] (14 PDB entries)
  8. 303414Domain d1o3qa2: 1o3q A:8-137 [86606]
    Other proteins in same PDB: d1o3qa1
    complexed with cmp

Details for d1o3qa2

PDB Entry: 1o3q (more details), 3 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes

SCOP Domain Sequences for d1o3qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o3qa2 b.82.3.2 (A:8-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

SCOP Domain Coordinates for d1o3qa2:

Click to download the PDB-style file with coordinates for d1o3qa2.
(The format of our PDB-style files is described here.)

Timeline for d1o3qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o3qa1