Lineage for d1o0ia_ (1o0i A:)
- Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) 
Family d.38.1.5: PaaI/YdiI-like [89902] (2 proteins) Protein Hypothetical protein HI1161 [89905] (1 species) Species Haemophilus influenzae [TaxId:727] [89906] (1 PDB entry) 
Domain d1o0ia_: 1o0i A: [86532]
Details for d1o0ia_
PDB Entry: 1o0i (more details), 1.7 Å
PDB Description: x-ray structure of yb61_haein northeast structural genomics consortium target ir63.
SCOP Domain Sequences for d1o0ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0ia_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae}
lwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsval
aetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirte
enklccvsrltlsvinl
SCOP Domain Coordinates for d1o0ia_:
Click to download the PDB-style file with coordinates for d1o0ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o0ia_:
- d1o0ia_ is new in SCOP 1.65
- d1o0ia_ appears in SCOP 1.67
- d1o0ia_ last appears in SCOP 1.75
View in 3D
