SCOP 1.65: Domain d1nywa_: 1nyw A:

Lineage for d1nywa_ (1nyw A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (9 families)

5. Family b.82.1.1: dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51183] (1 protein)

6. Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (3 species)
   synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase

7. Species Streptococcus suis [89402] (3 PDB entries)

8. Domain d1nywa_: 1nyw A: [86429]

Details for d1nywa_

PDB Entry: 1nyw, 1.6 Å

PDB Description: The high resolution structures of RmlC from Streptoccus suis in complex with dTDP-D-glucose

SCOP Domain Sequences for d1nywa_:

Sequence; same for both SEQRES and ATOM records:

>d1nywa_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis}
nffgktlaarpveaipgmlefdipvhgdnrgwfkenfqkekmlplgfpesffaegklqnn
vsfsrknvlrglhaepwdkyisvadggkvlgtwvdlregetfgntyqtvidasksifvpr
gvangfqvlsdfvaysylvndywalelkpkyafvnyadpsldikwenleeaevseadenh
pflkdvkplrkedl

Timeline for d1nywa_:

• d1nywa_ is new in SCOP 1.65
  
• d1nywa_ appears in SCOP 1.67
  
• d1nywa_ appears in the current release, SCOPe 2.08