SCOPe 2.08: Domain d1nxzb1: 1nxz B:2-73

Lineage for d1nxzb1 (1nxz B:2-73)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.2: YggJ N-terminal domain-like [89451] (3 proteins)

6. Protein Hypothetical protein HI0303 [89452] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [89453] (2 PDB entries)

8. Domain d1nxzb1: 1nxz B:2-73 [86393]
   Other proteins in same PDB: d1nxza2, d1nxza3, d1nxzb2, d1nxzb3
   structural genomics

Details for d1nxzb1

PDB Entry: 1nxz, 2 Å

PDB Description: X-Ray Crystal Structure of Protein yggj_haein of Haemophilus influenzae. Northeast Structural Genomics Consortium Target IR73.

PDB Compounds: (B:) Hypothetical protein HI0303

SCOPe Domain Sequences for d1nxzb1:

Sequence; same for both SEQRES and ATOM records:

>d1nxzb1 b.122.1.2 (B:2-73) Hypothetical protein HI0303 {Haemophilus influenzae [TaxId: 727]}
ripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkks
vkveilgrelad

Timeline for d1nxzb1:

• d1nxzb1 first appeared in SCOP 1.65
  
• d1nxzb1 appears in SCOPe 2.07