SCOP 1.65: Domain d1nwyu_: 1nwy U:

Lineage for d1nwyu_ (1nwy U:)

1. Root: SCOP 1.65

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein 50S subunit [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (13 PDB entries)

8. Domain d1nwyu_: 1nwy U: [86365]

Details for d1nwyu_

PDB Entry: 1nwy, 3.3 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin

SCOP Domain Sequences for d1nwyu_:

Sequence; same for both SEQRES and ATOM records:

>d1nwyu_ i.1.1.2 (U:) 50S subunit {Deinococcus radiodurans}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaqte

Timeline for d1nwyu_:

• d1nwyu_ is new in SCOP 1.65
  
• d1nwyu_ appears in SCOP 1.67
  
• d1nwyu_ appears in the current release, SCOPe 2.08