Lineage for d1nwyp_ (1nwy P:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648286Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2648287Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 2648375Domain d1nwyp_: 1nwy P: [86360]
    CA-atoms only for the ribosomal protein structures
    complexed with zit

Details for d1nwyp_

PDB Entry: 1nwy (more details), 3.3 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin
PDB Compounds: (P:) ribosomal protein L21

SCOPe Domain Sequences for d1nwyp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwyp_ i.1.1.2 (P:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
mfaiiqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaev
vehgrgkkiyirkyksgvqyrrrtghrqnftaikilgiqg

SCOPe Domain Coordinates for d1nwyp_:

Click to download the PDB-style file with coordinates for d1nwyp_.
(The format of our PDB-style files is described here.)

Timeline for d1nwyp_: