Lineage for d1nwxi_ (1nwx I:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 345886Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 345887Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 346350Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 346354Protein 50S subunit [58125] (3 species)
  7. 346364Species Deinococcus radiodurans [TaxId:1299] [69993] (13 PDB entries)
  8. 346467Domain d1nwxi_: 1nwx I: [86322]

Details for d1nwxi_

PDB Entry: 1nwx (more details), 3.5 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with abt-773

SCOP Domain Sequences for d1nwxi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwxi_ i.1.1.2 (I:) 50S subunit {Deinococcus radiodurans}
impqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaapr
gavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrdr
rfmkivslapev

SCOP Domain Coordinates for d1nwxi_:

Click to download the PDB-style file with coordinates for d1nwxi_.
(The format of our PDB-style files is described here.)

Timeline for d1nwxi_: