Lineage for d1nudb4 (1nud B:141-460)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597009Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 597010Superfamily d.3.1: Cysteine proteinases [54001] (12 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 597239Family d.3.1.4: Transglutaminase catalytic domain [54044] (1 protein)
  6. 597240Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 597258Species Human (Homo sapiens), TGase E3 [TaxId:9606] [75334] (8 PDB entries)
  8. 597273Domain d1nudb4: 1nud B:141-460 [86181]
    Other proteins in same PDB: d1nuda1, d1nuda2, d1nuda3, d1nudb1, d1nudb2, d1nudb3
    complexed with br, ca, cl; mutant

Details for d1nudb4

PDB Entry: 1nud (more details), 2.7 Å

PDB Description: role of calcium ions in the activation and activity of the transglutaminase 3 enzyme (3 calciums, active form)

SCOP Domain Sequences for d1nudb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nudb4 d.3.1.4 (B:141-460) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3}
dsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqfeedilsiclsildrslnfrr
daatdvasrndpkyvgrvlsaminsnddngvlagnwsgtytggrdprswdgsveilknwk
ksglspvrygqcwvfagtlntalrslgipsrvitnfnsahdtdrnlsvdvyydpmgnpld
kgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqersqgvfqcgpasvigvregdvq
lnfdmpfifaevnadritwlydnttgkqwknsvnshtigryistkavgsnarmdvtdkyk
ypegsdqerqvfqkalgklk

SCOP Domain Coordinates for d1nudb4:

Click to download the PDB-style file with coordinates for d1nudb4.
(The format of our PDB-style files is described here.)

Timeline for d1nudb4: