Lineage for d1nudb2 (1nud B:480-593)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551360Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 551361Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 551362Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 551396Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (8 PDB entries)
  8. 551425Domain d1nudb2: 1nud B:480-593 [86179]
    Other proteins in same PDB: d1nuda1, d1nuda4, d1nudb1, d1nudb4

Details for d1nudb2

PDB Entry: 1nud (more details), 2.7 Å

PDB Description: role of calcium ions in the activation and activity of the transglutaminase 3 enzyme (3 calciums, active form)

SCOP Domain Sequences for d1nudb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nudb2 b.1.5.1 (B:480-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3}
psiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsat
msldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildn

SCOP Domain Coordinates for d1nudb2:

Click to download the PDB-style file with coordinates for d1nudb2.
(The format of our PDB-style files is described here.)

Timeline for d1nudb2: