Lineage for d1nuda4 (1nud A:141-460)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534280Family d.3.1.4: Transglutaminase core [54044] (3 proteins)
  6. 2534286Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 2534306Species Human (Homo sapiens), TGase E3 [TaxId:9606] [75334] (9 PDB entries)
  8. 2534322Domain d1nuda4: 1nud A:141-460 [86177]
    Other proteins in same PDB: d1nuda1, d1nuda2, d1nuda3, d1nudb1, d1nudb2, d1nudb3
    complexed with br, ca, cl

Details for d1nuda4

PDB Entry: 1nud (more details), 2.7 Å

PDB Description: role of calcium ions in the activation and activity of the transglutaminase 3 enzyme (3 calciums, active form)
PDB Compounds: (A:) Protein-glutamine glutamyltransferase E

SCOPe Domain Sequences for d1nuda4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuda4 d.3.1.4 (A:141-460) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
dsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqfeedilsiclsildrslnfrr
daatdvasrndpkyvgrvlsaminsnddngvlagnwsgtytggrdprswdgsveilknwk
ksglspvrygqcwvfagtlntalrslgipsrvitnfnsahdtdrnlsvdvyydpmgnpld
kgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqersqgvfqcgpasvigvregdvq
lnfdmpfifaevnadritwlydnttgkqwknsvnshtigryistkavgsnarmdvtdkyk
ypegsdqerqvfqkalgklk

SCOPe Domain Coordinates for d1nuda4:

Click to download the PDB-style file with coordinates for d1nuda4.
(The format of our PDB-style files is described here.)

Timeline for d1nuda4: