SCOP 1.67: Domain d1nt0a2: 1nt0 A:165-278

Lineage for d1nt0a2 (1nt0 A:165-278)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.23: CUB-like [49853] (2 superfamilies)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.23.1: Spermadhesin, CUB domain [49854] (1 family)

5. Family b.23.1.1: Spermadhesin, CUB domain [49855] (5 proteins)

6. Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (1 species)
   duplication: contains two CUB domains separated by an EGF-like domain

7. Species Rat (Rattus norvegicus) [TaxId:10116] [89257] (1 PDB entry)

8. Domain d1nt0a2: 1nt0 A:165-278 [86144]
   Other proteins in same PDB: d1nt0a3, d1nt0g3

Details for d1nt0a2

PDB Entry: 1nt0, 2.7 Å

PDB Description: crystal structure of the cub1-egf-cub2 region of masp2

SCOP Domain Sequences for d1nt0a2:

Sequence, based on SEQRES records:

>d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus)}
csgqvftgrsgflsspeypqpypklsscaynirleegfsitldfvesfdvemhpeaqcpy
dslkiqtdkreygpfcgktlpprietdsnkvtitfttdesgnhtgwkihytsta

Sequence, based on observed residues (ATOM records):

>d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus)}
csgqvftgrsgflsspeypqpypklsscaynirleegfsitldfvesfdvemhcdslkiq
tdkreygpfcgktlpprietdsnkvtitfttdesgnhtgwkihytsta

Timeline for d1nt0a2:

• d1nt0a2 first appeared in SCOP 1.65
  
• d1nt0a2 appears in SCOP 1.69
  
• d1nt0a2 appears in the current release, SCOPe 2.08