Lineage for d1nr0a2 (1nr0 A:313-611)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326994Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1327134Superfamily b.69.4: WD40 repeat-like [50978] (3 families) (S)
    also contains 8-bladed propellers
  5. 1327135Family b.69.4.1: WD40-repeat [50979] (11 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 1327136Protein Actin interacting protein 1 [89378] (2 species)
    14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands
  7. 1327144Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89379] (2 PDB entries)
  8. 1327146Domain d1nr0a2: 1nr0 A:313-611 [86079]
    complexed with mn

Details for d1nr0a2

PDB Entry: 1nr0 (more details), 1.7 Å

PDB Description: two seven-bladed beta-propeller domains revealed by the structure of a c. elegans homologue of yeast actin interacting protein 1 (aip1).
PDB Compounds: (A:) Actin interacting protein 1

SCOPe Domain Sequences for d1nr0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
lgsidqvryghnkaitalsssadgktlfsadaeghinswdistgisnrvfpdvhatmitg
ikttskgdlftvswddhlkvvpaggsgvdsskavanklssqplglavsadgdiavaacyk
hiaiyshgkltevpisynsscvalsndkqfvavggqdskvhvyklsgasvsevktivhpa
eitsvafsnngaflvatdqsrkvipysvannfelahtnswtfhtakvacvswspdnvrla
tgsldnsvivwnmnkpsdhpiiikgahamssvnsviwlnettivsagqdsnikfwnvpf

SCOPe Domain Coordinates for d1nr0a2:

Click to download the PDB-style file with coordinates for d1nr0a2.
(The format of our PDB-style files is described here.)

Timeline for d1nr0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nr0a1