SCOP 1.75: Domain d1nqla3: 1nql A:163-311

Lineage for d1nqla3 (1nql A:163-311)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (1 family)

5. Family g.3.9.1: Growth factor receptor domain [57185] (8 proteins)

6. Protein EGF receptor Cys-rich domains [82887] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82888] (6 PDB entries)

8. Domain d1nqla3: 1nql A:163-311 [86035]
   Other proteins in same PDB: d1nqla1, d1nqla2, d1nqlb_
   complexed with EGF

Details for d1nqla3

PDB Entry: 1nql, 2.8 Å

PDB Description: structure of the extracellular domain of human epidermal growth factor (egf) receptor in an inactive (low ph) complex with egf.

PDB Compounds: (A:) Epidermal growth factor receptor

SCOP Domain Sequences for d1nqla3:

Sequence; same for both SEQRES and ATOM records:

>d1nqla3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]}
cqkcdpscpngscwgageencqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpres
dclvcrkfrdeatckdtcpplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgs
cvracgadsyemeedgvrkckkcegpcrk

Timeline for d1nqla3:

• d1nqla3 first appeared in SCOP 1.65
  
• d1nqla3 appears in SCOP 1.73
  
• d1nqla3 appears in SCOPe 2.01
  
• d1nqla3 appears in the current release, SCOPe 2.08