Lineage for d1nq5o1 (1nq5 O:0-148,O:313-333)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 387801Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (14 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 387918Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species)
  7. 387930Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (10 PDB entries)
  8. 387949Domain d1nq5o1: 1nq5 O:0-148,O:313-333 [86012]
    Other proteins in same PDB: d1nq5a2, d1nq5c2, d1nq5o2, d1nq5q2

Details for d1nq5o1

PDB Entry: 1nq5 (more details), 2.11 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ser complexed with nad+

SCOP Domain Sequences for d1nq5o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nq5o1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d1nq5o1:

Click to download the PDB-style file with coordinates for d1nq5o1.
(The format of our PDB-style files is described here.)

Timeline for d1nq5o1: