SCOP 1.71: Domain d1npnc1: 1npn C:4-166

Lineage for d1npnc1 (1npn C:4-166)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (23 PDB entries)

8. Domain d1npnc1: 1npn C:4-166 [85969]

Details for d1npnc1

PDB Entry: 1npn, 1.8 Å

PDB Description: crystal structure of a copper reconstituted h145a mutant of nitrite reductase from alcaligenes faecalis

SCOP Domain Sequences for d1npnc1:

Sequence; same for both SEQRES and ATOM records:

>d1npnc1 b.6.1.3 (C:4-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgk

Timeline for d1npnc1:

• d1npnc1 first appeared in SCOP 1.65
  
• d1npnc1 appears in SCOP 1.69
  
• d1npnc1 appears in SCOP 1.73
  
• d1npnc1 appears in the current release, SCOPe 2.08