Lineage for d1np3c2 (1np3 C:1-182)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 309007Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (12 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 309018Protein Class I ketol-acid reductoisomerase (KARI) [89532] (1 species)
  7. 309019Species Pseudomonas aeruginosa [TaxId:287] [89533] (1 PDB entry)
  8. 309022Domain d1np3c2: 1np3 C:1-182 [85951]
    Other proteins in same PDB: d1np3a1, d1np3b1, d1np3c1, d1np3d1

Details for d1np3c2

PDB Entry: 1np3 (more details), 2 Å

PDB Description: Crystal structure of class I acetohydroxy acid isomeroreductase from Pseudomonas aeruginosa

SCOP Domain Sequences for d1np3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1np3c2 c.2.1.6 (C:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa}
mrvfydkdcdlsiiqgkkvaiigygsqghahacnlkdsgvdvtvglrsgsatvakaeahg
lkvadvktavaaadvvmiltpdefqgrlykeeiepnlkkgatlafahgfsihynqvvpra
dldvimiapkapghtvrsefvkgggipdliaiyqdasgnaknvalsyacgvgggrtgiie
tt

SCOP Domain Coordinates for d1np3c2:

Click to download the PDB-style file with coordinates for d1np3c2.
(The format of our PDB-style files is described here.)

Timeline for d1np3c2: