SCOPe 2.07: Domain d1nm4a_: 1nm4 A:

Lineage for d1nm4a_ (1nm4 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)
   automatically mapped to Pfam PF04234
   automatically mapped to Pfam PF13205

6. Protein Copper resistance protein C (CopC, PcoC) [81970] (3 species)

7. Species Pseudomonas syringae [TaxId:317] [81971] (4 PDB entries)

8. Domain d1nm4a_: 1nm4 A: [85870]

Details for d1nm4a_

PDB Entry: 1nm4

PDB Description: solution structure of cu(i)-copc from pseudomonas syringae

PDB Compounds: (A:) copper resistance protein c

SCOPe Domain Sequences for d1nm4a_:

Sequence; same for both SEQRES and ATOM records:

>d1nm4a_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 317]}
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk

Timeline for d1nm4a_:

• d1nm4a_ first appeared in SCOP 1.65
  
• d1nm4a_ appears in SCOPe 2.06
  
• d1nm4a_ appears in the current release, SCOPe 2.08