SCOP 1.65: Domain d1nfsb_: 1nfs B:

Lineage for d1nfsb_ (1nfs B:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (2 families)

5. Family d.113.1.2: Isopentenyl diphosphate isomerase [64369] (1 protein)

6. Protein Isopentenyl diphosphate isomerase [64370] (1 species)

7. Species Escherichia coli [TaxId:562] [64371] (6 PDB entries)

8. Domain d1nfsb_: 1nfs B: [85641]
   complexed with ded, mg, mn

Details for d1nfsb_

PDB Entry: 1nfs, 1.96 Å

PDB Description: structure and mechanism of action of isopentenylpyrophosphate- dimethylallylpyrophosphate isomerase: complex with nipp

SCOP Domain Sequences for d1nfsb_:

Sequence; same for both SEQRES and ATOM records:

>d1nfsb_ d.113.1.2 (B:) Isopentenyl diphosphate isomerase {Escherichia coli}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl

Timeline for d1nfsb_:

• d1nfsb_ is new in SCOP 1.65
  
• d1nfsb_ appears in SCOP 1.67
  
• d1nfsb_ appears in the current release, SCOPe 2.08, called d1nfsb1