SCOP 1.71: Domain d1nbqa2: 1nbq A:130-233

Lineage for d1nbqa2 (1nbq A:130-233)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (34 proteins)

6. Protein Junction adhesion molecule, JAM, C-terminal domain [49186] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89187] (1 PDB entry)

8. Domain d1nbqa2: 1nbq A:130-233 [85533]
   Other proteins in same PDB: d1nbqa1, d1nbqb1

Details for d1nbqa2

PDB Entry: 1nbq, 2.9 Å

PDB Description: Crystal Structure of Human Junctional Adhesion Molecule Type 1

SCOP Domain Sequences for d1nbqa2:

Sequence; same for both SEQRES and ATOM records:

>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens)}
vppskptvnipssatignravltcseqdgsppseytwfkdgivmptnpkstrafsnssyv
lnpttgelvfdplsasdtgeyscearngygtpmtsnavrmeave

Timeline for d1nbqa2:

• d1nbqa2 first appeared in SCOP 1.65
  
• d1nbqa2 appears in SCOP 1.69
  
• d1nbqa2 appears in SCOP 1.73
  
• d1nbqa2 appears in the current release, SCOPe 2.08