Lineage for d1nbqa2 (1nbq A:130-233)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454655Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 454834Protein Junction adhesion molecule, JAM, C-terminal domain [49186] (2 species)
  7. 454835Species Human (Homo sapiens) [TaxId:9606] [89187] (1 PDB entry)
  8. 454836Domain d1nbqa2: 1nbq A:130-233 [85533]
    Other proteins in same PDB: d1nbqa1, d1nbqb1

Details for d1nbqa2

PDB Entry: 1nbq (more details), 2.9 Å

PDB Description: Crystal Structure of Human Junctional Adhesion Molecule Type 1

SCOP Domain Sequences for d1nbqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens)}
vppskptvnipssatignravltcseqdgsppseytwfkdgivmptnpkstrafsnssyv
lnpttgelvfdplsasdtgeyscearngygtpmtsnavrmeave

SCOP Domain Coordinates for d1nbqa2:

Click to download the PDB-style file with coordinates for d1nbqa2.
(The format of our PDB-style files is described here.)

Timeline for d1nbqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nbqa1