Lineage for d1n9da_ (1n9d A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280090Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 280091Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglments of the two crossover connections
  5. 280092Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 280152Protein Prolactin (placental lactogen) [47278] (2 species)
  7. 280153Species Human (Homo sapiens) [TaxId:9606] [89035] (1 PDB entry)
  8. 280154Domain d1n9da_: 1n9d A: [85464]

Details for d1n9da_

PDB Entry: 1n9d (more details)

PDB Description: solution structure of human prolactin

SCOP Domain Sequences for d1n9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9da_ a.26.1.1 (A:) Prolactin (placental lactogen) {Human (Homo sapiens)}
lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht
sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie
eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh
kidnylkllkcriihnnnc

SCOP Domain Coordinates for d1n9da_:

Click to download the PDB-style file with coordinates for d1n9da_.
(The format of our PDB-style files is described here.)

Timeline for d1n9da_: