Lineage for d1n8r4_ (1n8r 4:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430415Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 430458Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 430459Protein Ribosomal protein L44e [57837] (1 species)
  7. 430460Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (18 PDB entries)
  8. 430475Domain d1n8r4_: 1n8r 4: [85427]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
    complexed with cd, cl, k, mg, na, vir; mutant

Details for d1n8r4_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M

SCOP Domain Sequences for d1n8r4_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8r4_ g.41.8.3 (4:) Ribosomal protein L44e {Archaeon Haloarcula marismortui}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOP Domain Coordinates for d1n8r4_:

Click to download the PDB-style file with coordinates for d1n8r4_.
(The format of our PDB-style files is described here.)

Timeline for d1n8r4_: