Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins) |
Protein Xanthine oxidase, domain 4 (?) [55452] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [55453] (11 PDB entries) Uniprot P80457 |
Domain d1n5xb4: 1n5x B:415-531 [85351] Other proteins in same PDB: d1n5xa1, d1n5xa2, d1n5xa3, d1n5xa5, d1n5xa6, d1n5xb1, d1n5xb2, d1n5xb3, d1n5xb5, d1n5xb6 complexed with fad, fes, mos, mte, tei |
PDB Entry: 1n5x (more details), 2.8 Å
SCOPe Domain Sequences for d1n5xb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n5xb4 d.87.2.1 (B:415-531) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]} deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkds
Timeline for d1n5xb4: