Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Bacterial alpha-amylase [51447] (8 species) |
Species Archaeon Pyrococcus woesei [TaxId:2262] [89464] (3 PDB entries) |
Domain d1mxga2: 1mxg A:1-361 [85194] Other proteins in same PDB: d1mxga1 complexed with acr, ca, eoh, ete, mg, trs, zn |
PDB Entry: 1mxg (more details), 1.6 Å
SCOP Domain Sequences for d1mxga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei} akyleleeggvimqafywdvpgggiwwdhirskipewyeagisaiwlpppskgmsggysm gydpydyfdlgeyyqkgtvetrfgskeelvrliqtahaygikviadvvinhraggdlewn pfvgdytwtdfskvasgkytanyldfhpnelhccdegtfggfpdichhkewdqywlwksn esyaaylrsigfdgwrfdyvkgygawvvrdwlnwwggwavgeywdtnvdallswayesga kvfdfplyykmdeafdnnnipalvyalqngqtvvsrdpfkavtfvanhdtdiiwnkypay afiltyegqpvifyrdfeewlnkdklinliwihdhlaggsttivyydndelifvrngdsr r
Timeline for d1mxga2: