SCOPe 2.08: Domain d1mxga2: 1mxg A:1-361

Lineage for d1mxga2 (1mxg A:1-361)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Bacterial alpha-amylase [51447] (10 species)

7. Species Pyrococcus woesei [TaxId:2262] [89464] (3 PDB entries)

8. Domain d1mxga2: 1mxg A:1-361 [85194]
   Other proteins in same PDB: d1mxga1
   complexed with ca, eoh, ete, mg, trs, zn
   has additional insertions and/or extensions that are not grouped together

Details for d1mxga2

PDB Entry: 1mxg, 1.6 Å

PDB Description: crystal structure of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei in complex with acarbose

PDB Compounds: (A:) alpha amylase

SCOPe Domain Sequences for d1mxga2:

Sequence; same for both SEQRES and ATOM records:

>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Pyrococcus woesei [TaxId: 2262]}
akyleleeggvimqafywdvpgggiwwdhirskipewyeagisaiwlpppskgmsggysm
gydpydyfdlgeyyqkgtvetrfgskeelvrliqtahaygikviadvvinhraggdlewn
pfvgdytwtdfskvasgkytanyldfhpnelhccdegtfggfpdichhkewdqywlwksn
esyaaylrsigfdgwrfdyvkgygawvvrdwlnwwggwavgeywdtnvdallswayesga
kvfdfplyykmdeafdnnnipalvyalqngqtvvsrdpfkavtfvanhdtdiiwnkypay
afiltyegqpvifyrdfeewlnkdklinliwihdhlaggsttivyydndelifvrngdsr
r

Timeline for d1mxga2:

• d1mxga2 first appeared in SCOP 1.65
  
• d1mxga2 appears in SCOPe 2.07