SCOP 1.65: Domain d1ms7a_: 1ms7 A:

Lineage for d1ms7a_ (1ms7 A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (21 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (2 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (39 PDB entries)

8. Domain d1ms7a_: 1ms7 A: [85081]

Details for d1ms7a_

PDB Entry: 1ms7, 1.97 Å

PDB Description: x-ray structure of the glur2 ligand-binding core (s1s2j) in complex with (s)-des-me-ampa at 1.97 a resolution, crystallization in the presence of zinc acetate

SCOP Domain Sequences for d1ms7a_:

Sequence; same for both SEQRES and ATOM records:

>d1ms7a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

Timeline for d1ms7a_:

• d1ms7a_ is new in SCOP 1.65
  
• d1ms7a_ appears in SCOP 1.67
  
• d1ms7a_ appears in the current release, SCOPe 2.08