SCOP 1.67: Domain d1mpxb2: 1mpx B:24-404

Lineage for d1mpxb2 (1mpx B:24-404)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.21: PepX catalytic domain-like [69581] (3 proteins)

6. Protein Alpha-amino acid ester hydrolase [89769] (2 species)

7. Species Xanthomonas citri [TaxId:346] [89770] (1 PDB entry)

8. Domain d1mpxb2: 1mpx B:24-404 [85044]
   Other proteins in same PDB: d1mpxa1, d1mpxb1, d1mpxc1, d1mpxd1

Details for d1mpxb2

PDB Entry: 1mpx, 1.9 Å

PDB Description: alpha-amino acid ester hydrolase labeled with selenomethionine

SCOP Domain Sequences for d1mpxb2:

Sequence; same for both SEQRES and ATOM records:

>d1mpxb2 c.69.1.21 (B:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri}
tspmtpditgkpfvaadasndyikrevmipmrdgvklhtvivlpkgaknapivltrtpyd
asgrterlasphmkdllsagddvfveggyirvfqdvrgkygsegdyvmtrplrgplnpse
vdhatdawdtidwlvknvsesngkvgmigssyegftvvmaltnphpalkvavpespmidg
wmgddwfnygafrqvnfdyftgqlskrgkgagiarqghddysnflqagsagdfakaagle
qlpwwhkltehaaydafwqeqaldkvmartplkvptmwlqglwdqedmwgaihsyaamep
rdkrntlnylvmgpwrhsqvnydgsalgalnfegdtarqfrhdvlrpffdqylvdgapka
dtppvfiyntgenhwdrlkaw

Timeline for d1mpxb2:

• d1mpxb2 first appeared in SCOP 1.65
  
• d1mpxb2 appears in SCOP 1.69
  
• d1mpxb2 appears in the current release, SCOPe 2.08