Lineage for d1mpxa2 (1mpx A:24-404)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508774Family c.69.1.21: PepX catalytic domain-like [69581] (4 proteins)
  6. 2508775Protein Alpha-amino acid ester hydrolase [89769] (2 species)
  7. 2508809Species Xanthomonas citri [TaxId:346] [89770] (1 PDB entry)
  8. 2508810Domain d1mpxa2: 1mpx A:24-404 [85042]
    Other proteins in same PDB: d1mpxa1, d1mpxb1, d1mpxc1, d1mpxd1
    complexed with ca, gol

Details for d1mpxa2

PDB Entry: 1mpx (more details), 1.9 Å

PDB Description: alpha-amino acid ester hydrolase labeled with selenomethionine
PDB Compounds: (A:) alpha-amino acid ester hydrolase

SCOPe Domain Sequences for d1mpxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}
tspmtpditgkpfvaadasndyikrevmipmrdgvklhtvivlpkgaknapivltrtpyd
asgrterlasphmkdllsagddvfveggyirvfqdvrgkygsegdyvmtrplrgplnpse
vdhatdawdtidwlvknvsesngkvgmigssyegftvvmaltnphpalkvavpespmidg
wmgddwfnygafrqvnfdyftgqlskrgkgagiarqghddysnflqagsagdfakaagle
qlpwwhkltehaaydafwqeqaldkvmartplkvptmwlqglwdqedmwgaihsyaamep
rdkrntlnylvmgpwrhsqvnydgsalgalnfegdtarqfrhdvlrpffdqylvdgapka
dtppvfiyntgenhwdrlkaw

SCOPe Domain Coordinates for d1mpxa2:

Click to download the PDB-style file with coordinates for d1mpxa2.
(The format of our PDB-style files is described here.)

Timeline for d1mpxa2: