Lineage for d1m9yg_ (1m9y G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330931Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2330932Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2330933Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2330972Protein HIV-1 capsid protein [47945] (1 species)
  7. 2330973Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2330995Domain d1m9yg_: 1m9y G: [84919]
    Other proteins in same PDB: d1m9ya_, d1m9yb_, d1m9ye_, d1m9yf_

Details for d1m9yg_

PDB Entry: 1m9y (more details), 1.9 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,g89a complex.
PDB Compounds: (G:) hiv-1 capsid

SCOPe Domain Sequences for d1m9yg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9yg_ a.73.1.1 (G:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvaaapiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

SCOPe Domain Coordinates for d1m9yg_:

Click to download the PDB-style file with coordinates for d1m9yg_.
(The format of our PDB-style files is described here.)

Timeline for d1m9yg_: