Lineage for d1m5qa_ (1m5q A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2787032Protein Sm-Like archaeal protein Smap3 [89317] (1 species)
    contains additional C-terminal alpha+beta domain
  7. 2787033Species Pyrobaculum aerophilum [TaxId:13773] [89318] (1 PDB entry)
  8. 2787036Domain d1m5qa_: 1m5q A: [84810]
    complexed with acy, cd, gol, na
    has additional subdomain(s) that are not in the common domain

Details for d1m5qa_

PDB Entry: 1m5q (more details), 2 Å

PDB Description: crystal structure of a novel sm-like archaeal protein from pyrobaculum aerophilum
PDB Compounds: (A:) small nuclear ribonucleoprotein homolog

SCOPe Domain Sequences for d1m5qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5qa_ b.38.1.1 (A:) Sm-Like archaeal protein Smap3 {Pyrobaculum aerophilum [TaxId: 13773]}
fvaelnnllgrevqvvlsngevykgvlhavdnqlnivlanasnkagekfnrvfimyryiv
hidsterridmrefakqaekifpgmvkyieetnvvligdkvrvseigvegvgpvaerakr
lfeefl

SCOPe Domain Coordinates for d1m5qa_:

Click to download the PDB-style file with coordinates for d1m5qa_.
(The format of our PDB-style files is described here.)

Timeline for d1m5qa_: