Lineage for d1m3uc_ (1m3u C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 684825Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 685012Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (1 protein)
  6. 685013Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species)
    dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme
  7. 685014Species Escherichia coli [TaxId:562] [89506] (1 PDB entry)
  8. 685017Domain d1m3uc_: 1m3u C: [84786]

Details for d1m3uc_

PDB Entry: 1m3u (more details), 1.8 Å

PDB Description: crystal structure of ketopantoate hydroxymethyltransferase complexed the product ketopantoate
PDB Compounds: (C:) 3-methyl-2-oxobutanoate hydroxymethyltransferase

SCOP Domain Sequences for d1m3uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3uc_ c.1.12.8 (C:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]}
pttisllqkykqekkrfatitaydysfaklfadeglnvmlvgdslgmtvqghdstlpvtv
adiayhtaavrrgapncllladlpfmayatpeqafenaatvmraganmvkieggewlvet
vqmlteravpvcghlgltpqsvnifggykvqgrgdeagdqllsdalaleaagaqllvlec
vpvelakritealaipvigigagnvtdgqilvmhdafgitgghipkfaknflaetgdira
avrqymaevesgvypgeehsfh

SCOP Domain Coordinates for d1m3uc_:

Click to download the PDB-style file with coordinates for d1m3uc_.
(The format of our PDB-style files is described here.)

Timeline for d1m3uc_: