SCOP 1.75: Domain d1m35f2: 1m35 F:177-440

Lineage for d1m35f2 (1m35 F:177-440)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Aminopeptidase P, C-terminal domain [55928] (2 species)

7. Species Escherichia coli [TaxId:562] [55929] (26 PDB entries)

8. Domain d1m35f2: 1m35 F:177-440 [84781]
   Other proteins in same PDB: d1m35a1, d1m35b1, d1m35c1, d1m35d1, d1m35e1, d1m35f1
   complexed with mn

Details for d1m35f2

PDB Entry: 1m35, 2.4 Å

PDB Description: Aminopeptidase P from Escherichia coli

PDB Compounds: (F:) aminopeptidase p

SCOP Domain Sequences for d1m35f2:

Sequence; same for both SEQRES and ATOM records:

>d1m35f2 d.127.1.1 (F:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

Timeline for d1m35f2:

• d1m35f2 first appeared in SCOP 1.65
  
• d1m35f2 appears in SCOP 1.73
  
• d1m35f2 appears in SCOPe 2.01
  
• d1m35f2 appears in the current release, SCOPe 2.08