SCOPe 2.08: Domain d1m27a_: 1m27 A:

Lineage for d1m27a_ (1m27 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein The Xlp protein Sap [55591] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55592] (6 PDB entries)

8. Domain d1m27a_: 1m27 A: [84748]
   Other proteins in same PDB: d1m27c_
   complex with Fyn SH3 domain and slam peptide, chain B
   complexed with flc

Details for d1m27a_

PDB Entry: 1m27, 2.5 Å

PDB Description: Crystal structure of SAP/FynSH3/SLAM ternary complex

PDB Compounds: (A:) sh2 domain protein 1a

SCOPe Domain Sequences for d1m27a_:

Sequence; same for both SEQRES and ATOM records:

>d1m27a_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]}
mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek

Timeline for d1m27a_:

• d1m27a_ first appeared in SCOP 1.65
  
• d1m27a_ appears in SCOPe 2.07