SCOP 1.73: Domain d1lkja_: 1lkj A:

Lineage for d1lkja_ (1lkj A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (10 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89052] (3 PDB entries)

8. Domain d1lkja_: 1lkj A: [84623]

Details for d1lkja_

PDB Entry: 1lkj

PDB Description: nmr structure of apo calmodulin from yeast saccharomyces cerevisiae

PDB Compounds: (A:) calmodulin

SCOP Domain Sequences for d1lkja_:

Sequence; same for both SEQRES and ATOM records:

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
hqiefseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdae
vddmlrevsdgsgeiniqqfaallsk

Timeline for d1lkja_:

• d1lkja_ first appeared in SCOP 1.65
  
• d1lkja_ appears in SCOP 1.71
  
• d1lkja_ appears in SCOP 1.75
  
• d1lkja_ appears in the current release, SCOPe 2.08