PDB entry 1lkj

View 1lkj on RCSB PDB site
Description: NMR Structure of Apo Calmodulin from Yeast Saccharomyces cerevisiae
Class: metal binding protein
Keywords: yeast calmodulin, saccharomyces cerevisiae, EF-hand, NMR
Deposited on 2002-04-25, released 2003-04-29
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-29, with a file datestamp of 2007-06-04.
Experiment type: NMR31
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lkja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lkjA (A:)
ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
hqiefseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdae
vddmlrevsdgsgeiniqqfaallsk