SCOP 1.75: Domain d1le9a2: 1le9 A:19-191

Lineage for d1le9a2 (1le9 A:19-191)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.5: p53-like transcription factors [49417] (7 families)
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
Species Mouse (Mus musculus) [TaxId:10090] [49429] (8 PDB entries)
Domain d1le9a2: 1le9 A:19-191 [84592]
Other proteins in same PDB: d1le9a1, d1le9b1, d1le9b2, d1le9e1, d1le9f1, d1le9f2

Details for d1le9a2

PDB Description: crystal structure of a nf-kb heterodimer bound to the ig/hiv-kb siti

PDB Compounds: (A:) nuclear factor nf-kappa-b p65 subunit

SCOP Domain Sequences for d1le9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le9a2 b.2.5.3 (A:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ayveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

SCOP Domain Coordinates for d1le9a2:

Click to download the PDB-style file with coordinates for d1le9a2.
(The format of our PDB-style files is described here.)

Timeline for d1le9a2: