Lineage for d1le5a1 (1le5 A:192-291)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375024Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2375071Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 2375078Species Mouse (Mus musculus) [TaxId:10090] [49254] (13 PDB entries)
  8. 2375097Domain d1le5a1: 1le5 A:192-291 [84583]
    Other proteins in same PDB: d1le5a2, d1le5a3, d1le5b1, d1le5b2, d1le5e2, d1le5e3, d1le5f1, d1le5f2
    protein/DNA complex

Details for d1le5a1

PDB Entry: 1le5 (more details), 2.75 Å

PDB Description: crystal structure of a nf-kb heterodimer bound to an ifnb-kb
PDB Compounds: (A:) nuclear factor nf-kappa-b p65 subunit

SCOPe Domain Sequences for d1le5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le5a1 b.1.18.1 (A:192-291) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv
frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

SCOPe Domain Coordinates for d1le5a1:

Click to download the PDB-style file with coordinates for d1le5a1.
(The format of our PDB-style files is described here.)

Timeline for d1le5a1: