Lineage for d1l6oa_ (1l6o A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296371Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 296372Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 296373Family b.36.1.1: PDZ domain [50157] (13 proteins)
  6. 296414Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (1 species)
  7. 296415Species African clawed frog (Xenopus laevis) [TaxId:8355] [89314] (1 PDB entry)
  8. 296416Domain d1l6oa_: 1l6o A: [84534]

Details for d1l6oa_

PDB Entry: 1l6o (more details), 2.2 Å

PDB Description: xenopus dishevelled pdz domain

SCOP Domain Sequences for d1l6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6oa_ b.36.1.1 (A:) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis)}
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvaklehhh

SCOP Domain Coordinates for d1l6oa_:

Click to download the PDB-style file with coordinates for d1l6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1l6oa_: