![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
![]() | Protein Protease Do (DegP, HtrA), catalytic domain [74969] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [89339] (1 PDB entry) |
![]() | Domain d1l1ja_: 1l1j A: [84516] catalytic domain only |
PDB Entry: 1l1j (more details), 2.8 Å
SCOPe Domain Sequences for d1l1ja_:
Sequence, based on SEQRES records: (download)
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} dyespivnvveacapavvkidvvktvktsffdpyfeqffkkwfgelppgferqvaslgsg fifdpegyiltnyhvvggadnitvtmldgskydaeyiggdeeldiavikikasdkkfpyl efgdsdkvkigewaiaignplgfqhtvtvgvvsatnrripkpdgsgyyvgliqtdaainp gnsggpllnihgevigintaivnpqeavnlgfaipintvkkfldtilt
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} dyespivnvveacapavvkidvvkttsffdpyfeqffkkwfgelppgferqvaslgsgfi fdpegyiltnyhvvggadnitvtmldgskydaeyiggdeeldiavikikasdkkfpylef gdsdkvkigewaiaignplgfqhtvtvgvvsatnrripkpdgsgyyvgliqtdaainpgn sggpllnihgevigintaivnpqeavnlgfaipintvkkfldtilt
Timeline for d1l1ja_: