SCOPe 2.08: Domain d1l0nk_: 1l0n K:

Lineage for d1l0nk_ (1l0n K:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family)
   automatically mapped to Pfam PF08997

5. Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins)

6. Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
   the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located

7. Species Cow (Bos taurus) [TaxId:9913] [81515] (12 PDB entries)
   Uniprot P07552

8. Domain d1l0nk_: 1l0n K: [84513]
   Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_
   complexed with fes, hem

Details for d1l0nk_

PDB Entry: 1l0n, 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex

PDB Compounds: (K:) cytochrome b-c1 complex 6.4K protein

SCOPe Domain Sequences for d1l0nk_:

Sequence; same for both SEQRES and ATOM records:

>d1l0nk_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaqlwgavgavglvsatdsrlildwvptin

Timeline for d1l0nk_:

• d1l0nk_ first appeared in SCOP 1.65
  
• d1l0nk_ appears in SCOPe 2.07