| Root: SCOPe 2.08 |
| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) ![]() |
| Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
| Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81497] (19 PDB entries) Uniprot P13272; precursor of chains I,E and V,R |
| Domain d1l0ne2: 1l0n E:1-69 [84507] Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_ complexed with fes, hem |
PDB Entry: 1l0n (more details), 2.6 Å
SCOPe Domain Sequences for d1l0ne2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0ne2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl
Timeline for d1l0ne2: