Details for d1l0nd2

PDB Entry: 1l0n (more details), 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex
PDB Compounds: (D:) cytochrome c1, heme protein

SCOPe Domain Sequences for d1l0nd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0nd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOPe Domain Coordinates for d1l0nd2:

Click to download the PDB-style file with coordinates for d1l0nd2.
(The format of our PDB-style files is described here.)

Timeline for d1l0nd2: