Details for d1l0nd2

PDB Entry: 1l0n (more details), 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex
PDB Compounds: (D:) cytochrome c1, heme protein

SCOPe Domain Sequences for d1l0nd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0nd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOPe Domain Coordinates for d1l0nd2 are not available.

Timeline for d1l0nd2:

Domains from same chain:
(mouse over for more information)
d1l0nd1
Domains from other chains:
(mouse over for more information)
d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_