SCOPe 2.08: Domain d1l0la1: 1l0l A:1-233

Lineage for d1l0la1 (1l0l A:1-233)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 1 [63408] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55997] (19 PDB entries)
   Uniprot P31800

8. Domain d1l0la1: 1l0l A:1-233 [84482]
   Other proteins in same PDB: d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le1, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_
   complexed with fes, fmx, hem

Details for d1l0la1

PDB Entry: 1l0l, 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone

PDB Compounds: (A:) ubiquinol-cytochrome c reductase complex core protein I

SCOPe Domain Sequences for d1l0la1:

Sequence; same for both SEQRES and ATOM records:

>d1l0la1 d.185.1.1 (A:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp

Timeline for d1l0la1:

• d1l0la1 first appeared in SCOP 1.65
  
• d1l0la1 appears in SCOPe 2.07