Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (16 species) |
Species Escherichia coli, Dps [TaxId:562] [47251] (8 PDB entries) ferritin homolog that binds to and protects DNA |
Domain d1jtsh_: 1jts H: [84213] complexed with trs |
PDB Entry: 1jts (more details), 2.6 Å
SCOPe Domain Sequences for d1jtsh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtsh_ a.25.1.1 (H:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]} llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr kaigeakdddtadiltaasrdldkflwfiesnie
Timeline for d1jtsh_: