Class a: All alpha proteins [46456] (179 folds) |
Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (2 families) contains dimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (5 proteins) |
Protein Dodecameric ferritin homolog [47250] (7 species) |
Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries) ferritin homolog that binds to and protects DNA |
Domain d1jrej_: 1jre J: [84202] |
PDB Entry: 1jre (more details), 2.65 Å
SCOP Domain Sequences for d1jrej_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrej_ a.25.1.1 (J:) Dodecameric ferritin homolog {Escherichia coli, Dps} nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv rkaigeakdddtadiltaasrdldkflwfiesnie
Timeline for d1jrej_: