SCOPe 2.07: Domain d1j2pc_: 1j2p C:

Lineage for d1j2pc_ (1j2p C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Archaeoglobus fulgidus [TaxId:2234] [90044] (2 PDB entries)

8. Domain d1j2pc_: 1j2p C: [84024]
   alpha-ring only

Details for d1j2pc_

PDB Entry: 1j2p, 2.6 Å

PDB Description: alpha-ring from the proteasome from archaeoglobus fulgidus

PDB Compounds: (C:) Proteasome alpha subunit

SCOPe Domain Sequences for d1j2pc_:

Sequence; same for both SEQRES and ATOM records:

>d1j2pc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Archaeoglobus fulgidus [TaxId: 2234]}
pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt
iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy
tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl
sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel
lkk

Timeline for d1j2pc_:

• d1j2pc_ first appeared in SCOP 1.65
  
• d1j2pc_ appears in SCOPe 2.06
  
• d1j2pc_ appears in the current release, SCOPe 2.08